
    zTi                         d Z ddlZddlmZ ddlmZ ddlmZ ddlmZ ddlmZ ddlm	Z	 dd	lm
Z
 dd
lmZ ddlmZ ddlmZ ddlmZ ddlmZ ddlmZ erddlmZ dZ G d deee
e   f         Z G d d      Zedk(  rddlmZ  e        yy)z8Represent a Sequence Record, a sequence with annotation.    N)Any)cast)Iterator)NoReturn)Optional)overload)Sequence)TYPE_CHECKING)Union)StreamModeError)
MutableSeq)Seq)UndefinedSequenceError)
SeqFeaturezdSeqRecord comparison is deliberately not implemented. Explicitly compare the attributes of interest.c                   @    e Zd ZdZdeddfdZdedee   ddfdZ	d	 Z
y)
_RestrictedDictaH  Dict which only allows sequences of given length as values (PRIVATE).

    This simple subclass of the Python dictionary is used in the SeqRecord
    object for holding per-letter-annotations.  This class is intended to
    prevent simple errors by only allowing python sequences (e.g. lists,
    strings and tuples) to be stored, and only if their length matches that
    expected (the length of the SeqRecord's seq object).  It cannot however
    prevent the entries being edited in situ (for example appending entries
    to a list).

    >>> x = _RestrictedDict(5)
    >>> x["test"] = "hello"
    >>> x
    {'test': 'hello'}

    Adding entries which don't have the expected length are blocked:

    >>> x["test"] = "hello world"
    Traceback (most recent call last):
    ...
    TypeError: Any per-letter annotation should be a Python sequence (list, tuple or string) of the same length as the biological sequence, here 5.

    The expected length is stored as a private attribute,

    >>> x._length
    5

    In order that the SeqRecord (and other objects using this class) can be
    pickled, for example for use in the multiprocessing library, we need to
    be able to pickle the restricted dictionary objects.

    Using the default protocol, which is 3 on Python 3,

    >>> import pickle
    >>> y = pickle.loads(pickle.dumps(x))
    >>> y
    {'test': 'hello'}
    >>> y._length
    5

    Using the highest protocol, which is 4 on Python 3,

    >>> import pickle
    >>> z = pickle.loads(pickle.dumps(x, pickle.HIGHEST_PROTOCOL))
    >>> z
    {'test': 'hello'}
    >>> z._length
    5
    lengthreturnNc                 N    t         j                  |        t        |      | _        y)z&Create an EMPTY restricted dictionary.N)dict__init__int_lengthselfr   s     @/home/agent/.local/lib/python3.12/site-packages/Bio/SeqRecord.pyr   z_RestrictedDict.__init__X   s    d6{    keyvaluec                     t        |d      r0t        |d      r$t        | d      r1t        |      | j                  k7  rt        d| j                   d      t        j                  | ||       y )N__len____getitem__r   zAny per-letter annotation should be a Python sequence (list, tuple or string) of the same length as the biological sequence, here .)hasattrlenr   	TypeErrorr   __setitem__)r   r   r   s      r   r'   z_RestrictedDict.__setitem__]   sg     y)5-0i(SZ4<<-G--1\\N!= 
 	sE*r   c                 >    |j                         D ]
  \  }}|| |<    y N)items)r   new_dictr   r   s       r   updatez_RestrictedDict.updatel   s%    "..* 	JCDI	r   )__name__
__module____qualname____doc__r   r   strr	   r   r'   r,    r   r   r   r   %   s>    0d#s #t #
+s +8C= +T +r   r   c                   0   e Zd ZU dZeez  Zeeef   Zee	d<   e
e   e	d<   edz  e	d<   	 	 	 	 	 	 	 d=ded   dz  dedz  d	ed
ede
e   dz  de
d   dz  dedz  deeee   f   dz  ddfdZedeeee   f   fd       Zej$                  deeee   f   ddfd       Zeded   dz  fd       Zej$                  ded   ddfd       Ze	 	 	 	 	 	 	 d=deez  dz  dedz  d	ed
ede
e   dz  de
d   dz  deeeez  f   dz  deeef   dz  dd fd       Zededefd       Zededd fd       Zd Zdee   fdZdedefdZdefdZ defdZ!defdZ"d edefd!Z#d"edefd#Z$defd$Z%d%ede&fd&Z'd%ede&fd'Z(d%e)de&fd(Z*d%e)de&fd)Z+d%ede&fd*Z,d%ede&fd+Z-defd,Z.d%ed d-d.ef   dd fd/Z/d%ed-d.ef   dd fd0Z0d>d1Z1d?d2Z2d?d3Z3d4 Z4d5 Z5	 	 	 	 	 	 	 d@ded	ed
edededededd fd6Z6	 	 	 	 	 	 	 	 	 	 	 	 dAd7ed8ed9ed:ed;edz  ded	ed
edededededd fd<Z7y)B	SeqRecorda:	  A SeqRecord object holds a sequence and information about it.

    Main attributes:
     - id          - Identifier such as a locus tag (string)
     - seq         - The sequence itself (Seq object or similar)

    Additional attributes:
     - name        - Sequence name, e.g. gene name (string)
     - description - Additional text (string)
     - dbxrefs     - List of database cross references (list of strings)
     - features    - Any (sub)features defined (list of SeqFeature objects)
     - annotations - Further information about the whole sequence (dictionary).
       Most entries are strings, or lists of strings.
     - letter_annotations - Per letter/symbol annotation (restricted
       dictionary). This holds Python sequences (lists, strings
       or tuples) whose length matches that of the sequence.
       A typical use would be to hold a list of integers
       representing sequencing quality scores, or a string
       representing the secondary structure.

    You will typically use Bio.SeqIO to read in sequences from files as
    SeqRecord objects.  However, you may want to create your own SeqRecord
    objects directly (see the __init__ method for further details):

    >>> from Bio.Seq import Seq
    >>> from Bio.SeqRecord import SeqRecord
    >>> record = SeqRecord(Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF"),
    ...                    id="YP_025292.1", name="HokC",
    ...                    description="toxic membrane protein")
    >>> print(record)
    ID: YP_025292.1
    Name: HokC
    Description: toxic membrane protein
    Number of features: 0
    Seq('MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF')

    If you want to save SeqRecord objects to a sequence file, use Bio.SeqIO
    for this.  For the special case where you want the SeqRecord turned into
    a string in a particular file format there is a format method which uses
    Bio.SeqIO internally:

    >>> print(record.format("fasta"))
    >YP_025292.1 toxic membrane protein
    MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF
    <BLANKLINE>

    You can also do things like slicing a SeqRecord, checking its length, etc

    >>> len(record)
    44
    >>> edited = record[:10] + record[11:]
    >>> print(edited.seq)
    MKQHKAMIVAIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF
    >>> print(record.seq)
    MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF

    annotationsdbxrefsN_per_letter_annotationsseq)r   r   idnamedescriptionfeaturesr   letter_annotationsr   c	                 @   |!t        |t        t        f      st        d      |t        |t              st        d      t        |t              st        d      t        |t              st        d      || _        || _        || _        || _        |g }nt        |t              st        d      || _
        |i }nt        |t              st        d      || _        d| _        ||| _        |
g }|| _        yt        |t              st        d      || _        y)	a  Create a SeqRecord.

        Arguments:
         - seq         - Sequence, required (Seq or MutableSeq)
         - id          - Sequence identifier, recommended (string)
         - name        - Sequence name, optional (string)
         - description - Sequence description, optional (string)
         - dbxrefs     - Database cross references, optional (list of strings)
         - features    - Any (sub)features, optional (list of SeqFeature objects)
         - annotations - Dictionary of annotations for the whole sequence
         - letter_annotations - Dictionary of per-letter-annotations, values
           should be strings, list or tuples of the same length as the full
           sequence.

        You will typically use Bio.SeqIO to read in sequences from files as
        SeqRecord objects.  However, you may want to create your own SeqRecord
        objects directly.

        Note that while an id is optional, we strongly recommend you supply a
        unique id string for each record.  This is especially important
        if you wish to write your sequences to a file.

        You can create a 'blank' SeqRecord object, and then populate the
        attributes later.
        Nz1seq argument should be a Seq or MutableSeq objectzid argument should be a stringz name argument should be a stringz'description argument should be a stringz.dbxrefs argument should be a list (of strings)z+annotations argument must be a dict or Nonez:features argument should be a list (of SeqFeature objects))
isinstancer   r   r&   r1   _seqr9   r:   r;   listr6   r   r5   r7   r=   r<   )	r   r8   r9   r:   r;   r6   r<   r5   r=   s	            r   r   zSeqRecord.__init__   s.   H ?:cC3D#EOPP>*R"5<==$$>??+s+EFF		& ?GGT*LMM KK.IJJ&'+$) '9D# H
 !	 Hd+L  !r   c                     | j                   4| j                  dnt        | j                        }t        |      | _         | j                   S )a_  Dictionary of per-letter-annotation for the sequence.

        For example, this can hold quality scores used in FASTQ or QUAL files.
        Consider this example using Bio.SeqIO to read in an example Solexa
        variant FASTQ file as a SeqRecord:

        >>> from Bio import SeqIO
        >>> record = SeqIO.read("Quality/solexa_faked.fastq", "fastq-solexa")
        >>> print("%s %s" % (record.id, record.seq))
        slxa_0001_1_0001_01 ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNN
        >>> print(list(record.letter_annotations))
        ['solexa_quality']
        >>> print(record.letter_annotations["solexa_quality"])
        [40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0, -1, -2, -3, -4, -5]

        The letter_annotations get sliced automatically if you slice the
        parent SeqRecord, for example taking the last ten bases:

        >>> sub_record = record[-10:]
        >>> print("%s %s" % (sub_record.id, sub_record.seq))
        slxa_0001_1_0001_01 ACGTNNNNNN
        >>> print(sub_record.letter_annotations["solexa_quality"])
        [4, 3, 2, 1, 0, -1, -2, -3, -4, -5]

        Any python sequence (i.e. list, tuple or string) can be recorded in
        the SeqRecord's letter_annotations dictionary as long as the length
        matches that of the SeqRecord's sequence.  e.g.

        >>> len(sub_record.letter_annotations)
        1
        >>> sub_record.letter_annotations["dummy"] = "abcdefghij"
        >>> len(sub_record.letter_annotations)
        2

        You can delete entries from the letter_annotations dictionary as usual:

        >>> del sub_record.letter_annotations["solexa_quality"]
        >>> sub_record.letter_annotations
        {'dummy': 'abcdefghij'}

        You can completely clear the dictionary easily as follows:

        >>> sub_record.letter_annotations = {}
        >>> sub_record.letter_annotations
        {}

        Note that if replacing the record's sequence with a sequence of a
        different length you must first clear the letter_annotations dict.
        r   r   )r7   r8   r%   r   r   s     r   r=   zSeqRecord.letter_annotations  sB    f ''/((*QDHHF+:&+ID(+++r   r   c                 &   t        |t              st        d      | j                  dnt	        | j                        t        fd|j                         D              rRt        ddj                  |j                         D cg c]  \  }}t	        |      k7  s| d|  c}}             | j                  t              | _
        n| j                  j                          t        j                  | j                  |       y c c}}w )Nz?The per-letter-annotations should be a (restricted) dictionary.r   c              3   :   K   | ]  }t        |      k7    y wr)   )r%   ).0valr   s     r   	<genexpr>z/SeqRecord.letter_annotations.<locals>.<genexpr>F  s     <cs3x6!<s   zNThe per-letter-annotations have the same length as the sequence, but found: 
 ,=rC   )r?   r   r&   r8   r%   anyvalues
ValueErrorjoinr*   r7   r   clearr,   )r   r   r   rG   r   s       @r   r=   zSeqRecord.letter_annotations>  s5   %&Q  hh&CM<U\\^<<abebjbj  LQ  LW  LW  LY  lp  @H  @C  EH  ]`  ad  ]e  io  ]oornsstuxtylz  lp  cq  br  s  ''/+:&+ID(((..0D00%8 lps   D	Dc                     | j                   S )z3The sequence itself, as a Seq or MutableSeq object.)r@   r   s    r   r8   zSeqRecord.seqP  s     yyr   c                 ,   |!t        |t        t        f      st        d      | j                  r*t        |       t        |      k7  rt        d      || _        y || _        | j                  dnt        | j                        }t        |      | _        y )Nz&seq must be a Seq or MutableSeq objectz,You must empty the letter annotations first!r   rC   )
r?   r   r   r&   r7   r%   rM   r@   r8   r   )r   r   r   s      r   r8   zSeqRecord.seqU  s~     ZZ7H%IDEE''4yCJ& !OPP "	DI((*QDHHF+:&+ID(r   c	           
      b   | t         ur | ||||||||      S | j                  |       }	||	_        ||	_        ||	_        ||	_        |g }||	_        |g }||	_        |i }||	_        d|	_	        |@|dn
t        |      }
t        |
      |	_	        t        j                  |	j                  |       |	S )zOFaster constructor for post-validated data like copies or validated parsed dataNr   rC   )r4   __new__r@   r9   r:   r;   r6   r<   r5   r7   r%   r   r   r,   )clsr8   r9   r:   r;   r6   r<   r5   r=   instr   s              r   _from_validatedzSeqRecord._from_validatedh  s     i"	 	 {{3		&?GH K&'+$)+Q3s8F+:&+ID(KK446HIr   indexc                      y r)   r2   r   rX   s     r   r"   zSeqRecord.__getitem__  s    .1r   c                      y r)   r2   rZ   s     r   r"   zSeqRecord.__getitem__  s    8;r   c                    t        |t        j                        r&| j                  t	        d      | j                  |   S t        |t
              r| j                  t	        d      t        |       }	 ddlm} d}|rQt        |       rEt        j                  | j                  |   | j                  | j                  | j                        }n@| j                  | j                  |   | j                  | j                  | j                        }d	| j                  v r| j                  d	   |j                  d	<   |j!                  |      \  }}}|d
k(  r| j"                  D ]  }	|	j$                  j&                  s|	j$                  j(                  rddl}
|
j-                  d       E	 ||	j$                  j.                  k  rD|	j$                  j0                  |k  r+|j"                  j3                  |	j5                  |               | j8                  j;                         D ]  \  }}||   |j8                  |<    |S t	        d      # t        $ r d}Y w xY w# t6        $ r Y w xY w)a  Return a sub-sequence or an individual letter.

        Slicing, e.g. my_record[5:10], returns a new SeqRecord for
        that sub-sequence with some annotation preserved as follows:

        * The name, id and description are kept as-is.
        * Any per-letter-annotations are sliced to match the requested
          sub-sequence.
        * Unless a stride is used, all those features which fall fully
          within the subsequence are included (with their locations
          adjusted accordingly). If you want to preserve any truncated
          features (e.g. GenBank/EMBL source features), you must
          explicitly add them to the new SeqRecord yourself.
        * With the exception of any molecule type, the annotations
          dictionary and the dbxrefs list are not used for the new
          SeqRecord, as in general they may not apply to the
          subsequence. If you want to preserve them, you must explicitly
          copy them to the new SeqRecord yourself.

        Using an integer index, e.g. my_record[5] is shorthand for
        extracting that letter from the sequence, my_record.seq[5].

        For example, consider this short protein and its secondary
        structure as encoded by the PDB (e.g. H for alpha helices),
        plus a simple feature for its histidine self phosphorylation
        site:

        >>> from Bio.Seq import Seq
        >>> from Bio.SeqRecord import SeqRecord
        >>> from Bio.SeqFeature import SeqFeature, SimpleLocation
        >>> rec = SeqRecord(Seq("MAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLAT"
        ...                     "EMMSEQDGYLAESINKDIEECNAIIEQFIDYLR"),
        ...                 id="1JOY", name="EnvZ",
        ...                 description="Homodimeric domain of EnvZ from E. coli")
        >>> rec.letter_annotations["secondary_structure"] = "  S  SSSSSSHHHHHTTTHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHTT  "
        >>> rec.features.append(SeqFeature(SimpleLocation(20, 21),
        ...                     type = "Site"))

        Now let's have a quick look at the full record,

        >>> print(rec)
        ID: 1JOY
        Name: EnvZ
        Description: Homodimeric domain of EnvZ from E. coli
        Number of features: 1
        Per letter annotation for: secondary_structure
        Seq('MAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEE...YLR')
        >>> rec.letter_annotations["secondary_structure"]
        '  S  SSSSSSHHHHHTTTHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHTT  '
        >>> print(rec.features[0].location)
        [20:21]

        Now let's take a sub sequence, here chosen as the first (fractured)
        alpha helix which includes the histidine phosphorylation site:

        >>> sub = rec[11:41]
        >>> print(sub)
        ID: 1JOY
        Name: EnvZ
        Description: Homodimeric domain of EnvZ from E. coli
        Number of features: 1
        Per letter annotation for: secondary_structure
        Seq('RTLLMAGVSHDLRTPLTRIRLATEMMSEQD')
        >>> sub.letter_annotations["secondary_structure"]
        'HHHHHTTTHHHHHHHHHHHHHHHHHHHHHH'
        >>> print(sub.features[0].location)
        [9:10]

        You can also of course omit the start or end values, for
        example to get the first ten letters only:

        >>> print(rec[:10])
        ID: 1JOY
        Name: EnvZ
        Description: Homodimeric domain of EnvZ from E. coli
        Number of features: 0
        Per letter annotation for: secondary_structure
        Seq('MAAGVKQLAD')

        Or for the last ten letters:

        >>> print(rec[-10:])
        ID: 1JOY
        Name: EnvZ
        Description: Homodimeric domain of EnvZ from E. coli
        Number of features: 0
        Per letter annotation for: secondary_structure
        Seq('IIEQFIDYLR')

        If you omit both, then you get a copy of the original record (although
        lacking the annotations and dbxrefs):

        >>> print(rec[:])
        ID: 1JOY
        Name: EnvZ
        Description: Homodimeric domain of EnvZ from E. coli
        Number of features: 1
        Per letter annotation for: secondary_structure
        Seq('MAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEE...YLR')

        Finally, indexing with a simple integer is shorthand for pulling out
        that letter from the sequence directly:

        >>> rec[5]
        'K'
        >>> rec.seq[5]
        'K'
        Nz5Seq in SeqRecord is None, it doesn't support indexingz,Seq in SeqRecord is None, we cannot slice itr   )DBSeqRecordTF)r9   r:   r;   molecule_type   z}When slicing SeqRecord objects, any SeqFeature referencing other sequences (e.g. from segmented GenBank records) are ignored.zInvalid index)r?   numbersIntegralr8   rM   slicer%   BioSQL.BioSeqr]   ImportErrorr4   rW   r9   r:   r;   r5   indicesr<   locationrefref_dbwarningswarnstartendappend_shiftr&   r=   r*   )r   rX   parent_lengthr]   biosql_availableanswerrk   stopstepfri   r   r   s                r   r"   zSeqRecord.__getitem__  s?   Z eW--. xx K  88E?"u%xx !OPPIM)5#'   Jt[$A"22HHUOww $ 0 0	 3  --HHUOww $ 0 0	 .   $"2"226:6F6F6W""?3 !&m <E4qy  Azz~~):):' K
 ! AJJ$4$4449O"OO22188UF3CD( #55;;= >
U16u))#.> M))y  )#( )d % s%   5I &AIII	I%$I%c                 Z    | j                   t        d      t        | j                         S )a)  Iterate over the letters in the sequence.

        For example, using Bio.SeqIO to read in a protein FASTA file:

        >>> from Bio import SeqIO
        >>> record = SeqIO.read("Fasta/loveliesbleeding.pro", "fasta")
        >>> for amino in record:
        ...     print(amino)
        ...     if amino == "L": break
        X
        A
        G
        L
        >>> print(record.seq[3])
        L

        This is just a shortcut for iterating over the sequence directly:

        >>> for amino in record.seq:
        ...     print(amino)
        ...     if amino == "L": break
        X
        A
        G
        L
        >>> print(record.seq[3])
        L

        Note that this does not facilitate iteration together with any
        per-letter-annotation.  However, you can achieve that using the
        python zip function on the record (or its sequence) and the relevant
        per-letter-annotation:

        >>> from Bio import SeqIO
        >>> rec = SeqIO.read("Quality/solexa_faked.fastq", "fastq-solexa")
        >>> print("%s %s" % (rec.id, rec.seq))
        slxa_0001_1_0001_01 ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNN
        >>> print(list(rec.letter_annotations))
        ['solexa_quality']
        >>> for nuc, qual in zip(rec, rec.letter_annotations["solexa_quality"]):
        ...     if qual > 35:
        ...         print("%s %i" % (nuc, qual))
        A 40
        C 39
        G 38
        T 37
        A 36

        You may agree that using zip(rec.seq, ...) is more explicit than using
        zip(rec, ...) as shown above.
        z/Seq in SeqRecord is None, can't iterate over it)r@   rM   iterrQ   s    r   __iter__zSeqRecord.__iter__\  s)    h 99NOODIIr   charc                 L    | j                   t        d      || j                   v S )ar  Implement the 'in' keyword, searches the sequence.

        e.g.

        >>> from Bio import SeqIO
        >>> record = SeqIO.read("Fasta/sweetpea.nu", "fasta")
        >>> "GAATTC" in record
        False
        >>> "AAA" in record
        True

        This essentially acts as a proxy for using "in" on the sequence:

        >>> "GAATTC" in record.seq
        False
        >>> "AAA" in record.seq
        True

        Note that you can also use Seq objects as the query,

        >>> from Bio.Seq import Seq
        >>> Seq("AAA") in record
        True

        See also the Seq object's __contains__ method.
        0Seq in SeqRecord is None, can't convert to bytes)r@   rM   )r   rx   s     r   __contains__zSeqRecord.__contains__  s)    6 99OPPtyy  r   c                 Z    | j                   t        d      t        | j                         S )Nrz   )r@   rM   bytesrQ   s    r   	__bytes__zSeqRecord.__bytes__  s'    99OPPTYYr   c                    g }| j                   r|j                  d| j                           | j                  r|j                  d| j                          | j                  r|j                  d| j                          | j                  r-|j                  ddj                  | j                        z          |j                  dt        | j                                | j                  D ]&  }|j                  d| d| j                  |          ( | j                  r-|j                  d	dj                  | j                        z          | j                  =	 t        | j                         t        | j                        }|j                  |       n|j                  d       dj                  |      S # t        $ r* |j                  d
t        | j                                Y Cw xY w)aL  Return a human readable summary of the record and its annotation (string).

        The python built in function str works by calling the object's __str__
        method.  e.g.

        >>> from Bio.Seq import Seq
        >>> from Bio.SeqRecord import SeqRecord
        >>> record = SeqRecord(Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF"),
        ...                    id="YP_025292.1", name="HokC",
        ...                    description="toxic membrane protein, small")
        >>> print(str(record))
        ID: YP_025292.1
        Name: HokC
        Description: toxic membrane protein, small
        Number of features: 0
        Seq('MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF')

        In this example you don't actually need to call str explicitly, as the
        print command does this automatically:

        >>> print(record)
        ID: YP_025292.1
        Name: HokC
        Description: toxic membrane protein, small
        Number of features: 0
        Seq('MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF')

        Note that long sequences are shown truncated.
        zID: zName: zDescription: zDatabase cross-references: z, zNumber of features: /rJ   zPer letter annotation for: zUndefined sequence of length zMissing Sequence (None)
)r9   rm   r:   r;   r6   rN   r%   r<   r5   r=   r8   r}   reprr   )r   linesar8   s       r   __str__zSeqRecord.__str__  s   < 77LL4y)*99LL6$))-.LL=)9)9(:;<<<LL64<<9PPQ+C,>+?@A!! 	:ALL1QCq!1!1!!4 789	:""LL-		$:Q:Q0RR 88"dhh
 488nS!LL23yy * N<S]OLMNs   F: :0G-,G-c                     | j                   j                   d| j                  d| j                  d| j                  d| j
                  d| j                  dS )a  Return a concise summary of the record for debugging (string).

        The python built in function repr works by calling the object's __repr__
        method.  e.g.

        >>> from Bio.Seq import Seq
        >>> from Bio.SeqRecord import SeqRecord
        >>> rec = SeqRecord(Seq("MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKAT"
        ...                     "GEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQ"
        ...                     "SGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQ"
        ...                     "PQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF"),
        ...                 id="NP_418483.1", name="b4059",
        ...                 description="ssDNA-binding protein",
        ...                 dbxrefs=["ASAP:13298", "GI:16131885", "GeneID:948570"])
        >>> print(repr(rec))
        SeqRecord(seq=Seq('MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTE...IPF'), id='NP_418483.1', name='b4059', description='ssDNA-binding protein', dbxrefs=['ASAP:13298', 'GI:16131885', 'GeneID:948570'])

        At the python prompt you can also use this shorthand:

        >>> rec
        SeqRecord(seq=Seq('MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTE...IPF'), id='NP_418483.1', name='b4059', description='ssDNA-binding protein', dbxrefs=['ASAP:13298', 'GI:16131885', 'GeneID:948570'])

        Note that long sequences are shown truncated. Also note that any
        annotations, letter_annotations and features are not shown (as they
        would lead to a very long string).
        z(seq=z, id=z, name=z, description=z
, dbxrefs=))	__class__r-   r8   r9   r:   r;   r6   rQ   s    r   __repr__zSeqRecord.__repr__  s`    8 ~~&&'uTXXLdgg[ IYYM0@0@/C D'q*	
r   formatc                 $    | j                  |      S )aX  Return the record as a string in the specified file format.

        The format should be a lower case string supported as an output
        format by Bio.SeqIO, which is used to turn the SeqRecord into a
        string.  e.g.

        >>> from Bio.Seq import Seq
        >>> from Bio.SeqRecord import SeqRecord
        >>> record = SeqRecord(Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF"),
        ...                    id="YP_025292.1", name="HokC",
        ...                    description="toxic membrane protein")
        >>> record.format("fasta")
        '>YP_025292.1 toxic membrane protein\nMKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF\n'
        >>> print(record.format("fasta"))
        >YP_025292.1 toxic membrane protein
        MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF
        <BLANKLINE>

        The Python print function automatically appends a new line, meaning
        in this example a blank line is shown.  If you look at the string
        representation you can see there is a trailing new line (shown as
        slash n) which is important when writing to a file or if
        concatenating multiple sequence strings together.

        Note that this method will NOT work on every possible file format
        supported by Bio.SeqIO (e.g. some are for multiple sequences only,
        and binary formats are not supported).
        )
__format__)r   r   s     r   r   zSeqRecord.format  s    < v&&r   format_specc                     |st        |       S ddlm} |j                  |   }	 |j	                  |       S # t
        $ r t        d|z        dw xY w)a  Return the record as a string in the specified file format.

        This method supports the Python format() function and f-strings.
        The format_spec should be a lower case string supported by
        Bio.SeqIO as a text output file format. Requesting a binary file
        format raises a ValueError. e.g.

        >>> from Bio.Seq import Seq
        >>> from Bio.SeqRecord import SeqRecord
        >>> record = SeqRecord(Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF"),
        ...                    id="YP_025292.1", name="HokC",
        ...                    description="toxic membrane protein")
        ...
        >>> format(record, "fasta")
        '>YP_025292.1 toxic membrane protein\nMKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF\n'
        >>> print(f"Here is {record.id} in FASTA format:\n{record:fasta}")
        Here is YP_025292.1 in FASTA format:
        >YP_025292.1 toxic membrane protein
        MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF
        <BLANKLINE>

        See also the SeqRecord's format() method.
        r   )SeqIOz<Binary format %s cannot be used with SeqRecord format methodN)r1   Bior   _FormatToWriter	to_stringr   rM   )r   r   r   rU   s       r   r   zSeqRecord.__format__5  sd    0 t9##K0	==&& 	N 	s	   5 Ac                 H    | j                   t        | j                         S dS )a"  Return the length of the sequence.

        For example, using Bio.SeqIO to read in a FASTA nucleotide file:

        >>> from Bio import SeqIO
        >>> record = SeqIO.read("Fasta/sweetpea.nu", "fasta")
        >>> len(record)
        309
        >>> len(record.seq)
        309
        r   )r@   r%   rQ   s    r   r!   zSeqRecord.__len__[  s      "&!6s499~=A=r   otherc                      t        t              )z/Define the less-than operand (not implemented).NotImplementedError_NO_SEQRECORD_COMPARISONr   r   s     r   __lt__zSeqRecord.__lt__i      !":;;r   c                      t        t              )z;Define the less-than-or-equal-to operand (not implemented).r   r   s     r   __le__zSeqRecord.__le__m  r   r   c                      t        t              )z.Define the equal-to operand (not implemented).r   r   s     r   __eq__zSeqRecord.__eq__q  r   r   c                      t        t              )z2Define the not-equal-to operand (not implemented).r   r   s     r   __ne__zSeqRecord.__ne__u  r   r   c                      t        t              )z2Define the greater-than operand (not implemented).r   r   s     r   __gt__zSeqRecord.__gt__y  r   r   c                      t        t              )z>Define the greater-than-or-equal-to operand (not implemented).r   r   s     r   __ge__zSeqRecord.__ge__}  r   r   c                      y)a  Boolean value of an instance of this class (True).

        This behaviour is for backwards compatibility, since until the
        __len__ method was added, a SeqRecord always evaluated as True.

        Note that in comparison, a Seq object will evaluate to False if it
        has a zero length sequence.

        WARNING: The SeqRecord may in future evaluate to False when its
        sequence is of zero length (in order to better match the Seq
        object behaviour)!
        Tr2   rQ   s    r   __bool__zSeqRecord.__bool__  s     r   r   r   c                    | j                   t        d      t        |t              su t	        |       | j                   |z   | j
                  | j                  | j                  | j                  dd | j                  j                         | j                  dd       S |j                   t        d      | j                  | j                   |j                   z   | j                  dd | j                  dd       }t        |       }|j                  D ],  }|j                  j                  |j                  |             . ~|j                  D ],  }||j                  vs|j                  j                  |       . | j
                  |j
                  k(  r| j
                  |_        | j                  |j                  k(  r| j                  |_        | j                  |j                  k(  r| j                  |_        | j                  j!                         D ]6  \  }}||j                  v s|j                  |   |k(  s(||j                  |<   8 	 | j"                  j!                         D ]E  \  }}||j"                  v st$        j'                  |j"                  |||j"                  |   z          G 	 |S # t(        $ r t+        d        w xY w)a
  Add another sequence or string to this sequence.

        The other sequence can be a SeqRecord object, a Seq object (or
        similar, e.g. a MutableSeq) or a plain Python string. If you add
        a plain string or a Seq (like) object, the new SeqRecord will simply
        have this appended to the existing data. However, any per letter
        annotation will be lost:

        >>> from Bio import SeqIO
        >>> record = SeqIO.read("Quality/solexa_faked.fastq", "fastq-solexa")
        >>> print("%s %s" % (record.id, record.seq))
        slxa_0001_1_0001_01 ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNN
        >>> print(list(record.letter_annotations))
        ['solexa_quality']

        >>> new = record + "ACT"
        >>> print("%s %s" % (new.id, new.seq))
        slxa_0001_1_0001_01 ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNNACT
        >>> print(list(new.letter_annotations))
        []

        The new record will attempt to combine the annotation, but for any
        ambiguities (e.g. different names) it defaults to omitting that
        annotation.

        >>> from Bio import SeqIO
        >>> with open("GenBank/pBAD30.gb") as handle:
        ...     plasmid = SeqIO.read(handle, "gb")
        >>> print("%s %i" % (plasmid.id, len(plasmid)))
        pBAD30 4923

        Now let's cut the plasmid into two pieces, and join them back up the
        other way round (i.e. shift the starting point on this plasmid, have
        a look at the annotated features in the original file to see why this
        particular split point might make sense):

        >>> left = plasmid[:3765]
        >>> right = plasmid[3765:]
        >>> new = right + left
        >>> print("%s %i" % (new.id, len(new)))
        pBAD30 4923
        >>> str(new.seq) == str(right.seq + left.seq)
        True
        >>> len(new.features) == len(left.features) + len(right.features)
        True

        When we add the left and right SeqRecord objects, their annotation
        is all consistent, so it is all conserved in the new SeqRecord:

        >>> new.id == left.id == right.id == plasmid.id
        True
        >>> new.name == left.name == right.name == plasmid.name
        True
        >>> new.description == plasmid.description
        True
        >>> new.annotations == left.annotations == right.annotations
        True
        >>> new.letter_annotations == plasmid.letter_annotations
        True
        >>> new.dbxrefs == left.dbxrefs == right.dbxrefs
        True

        However, we should point out that when we sliced the SeqRecord,
        any annotations dictionary or dbxrefs list entries were lost.
        You can explicitly copy them like this:

        >>> new.annotations = plasmid.annotations.copy()
        >>> new.dbxrefs = plasmid.dbxrefs[:]
        Nz Left operand seq=None, can't addr9   r:   r;   r<   r5   r6   z'Right SeqRecord has seq=None, can't add)r<   r6   z2Failed while try to concatenate letter annotations)r@   rM   r?   r4   typer9   r:   r;   r<   r5   copyr6   rW   r%   rm   rn   r*   r=   r   r'   r&   print)r   r   rq   r   rt   rg   kvs           r   __add__zSeqRecord.__add__  sz   R 99?@@%+ 4:		E!77YY ,,q) ,,113Q  ::FGG %%II

"T]]1-=t||TU & 
 T 	5AOO""188F#34	5== 	+C&..(%%c*	+
 77ehhFI99

"))FKu000!%!1!1F$$**, 	*DAqE%%%%*;*;A*>!*C()""1%	*	//557 1000$$11E44Q77 	  	FG	s   .J2 <3J2 2Kc                    t        |t              rt        d      | j                  t	        d      t        |      } t        |       t        t        t        z  || j                  z         | j                  | j                  | j                  | j                  D cg c]  }|j                  |       c}| j                  j!                         | j"                  dd       S c c}w )aA  Add another sequence or string to this sequence (from the left).

        This method handles adding a Seq object (or similar, e.g. MutableSeq)
        or a plain Python string (on the left) to a SeqRecord (on the right).
        See the __add__ method for more details, but for example:

        >>> from Bio import SeqIO
        >>> record = SeqIO.read("Quality/solexa_faked.fastq", "fastq-solexa")
        >>> print("%s %s" % (record.id, record.seq))
        slxa_0001_1_0001_01 ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNN
        >>> print(list(record.letter_annotations))
        ['solexa_quality']

        >>> new = "ACT" + record
        >>> print("%s %s" % (new.id, new.seq))
        slxa_0001_1_0001_01 ACTACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNN
        >>> print(list(new.letter_annotations))
        []
        zMThis should have happened via the __add__ of the other SeqRecord being added!Nz5Can't add (right hand side) SeqRecord with seq = Noner   )r?   r4   RuntimeErrorr8   r&   r%   r   r   r   r   r9   r:   r;   r<   rn   r5   r   r6   )r   r   offsetrt   s       r   __radd__zSeqRecord.__radd__  s    ( eY'3  88STT UtDzz!5488#34ww((04>1ahhv&>((--/LLO
 	

 ?s   C"c                 j    | j                   t        d      | j                  j                  |||      S )zReturn the number of non-overlapping occurrences of sub in seq[start:end].

        Optional arguments start and end are interpreted as in slice notation.
        This method behaves as the count method of Python strings.
        zDseq is SeqRecord is None, assign it a sequence before applying count)r@   rM   r8   count)r   subrk   rl   s       r   r   zSeqRecord.count<  s7     99V  xx~~c5#..r   c                    | j                   t        d      | j                  | j                   j                         | j                  | j
                  | j                  | j                  dd | j                  dd | j                  j                         | j                  d      S | j                  j                               S )a  Return a copy of the record with an upper case sequence.

        All the annotation is preserved unchanged. e.g.

        >>> from Bio.Seq import Seq
        >>> from Bio.SeqRecord import SeqRecord
        >>> record = SeqRecord(Seq("acgtACGT"), id="Test",
        ...                    description = "Made up for this example")
        >>> record.letter_annotations["phred_quality"] = [1, 2, 3, 4, 5, 6, 7, 8]
        >>> print(record.upper().format("fastq"))
        @Test Made up for this example
        ACGTACGT
        +
        "#$%&'()
        <BLANKLINE>

        Naturally, there is a matching lower method:

        >>> print(record.lower().format("fastq"))
        @Test Made up for this example
        acgtacgt
        +
        "#$%&'()
        <BLANKLINE>
        NzDseq is SeqRecord is None, assign it a sequence before applying upperr9   r:   r;   r6   r<   r5   r=   )r8   rM   rW   upperr9   r:   r;   r6   r<   r5   r   r7   r=   rQ   s    r   r   zSeqRecord.upperH  s    4 88V  ##HHNNww((LLO]]1%((--/ //7  $ 
 	
 ,,113 $ 
 	
r   c                    | j                   t        d      | j                  | j                   j                         | j                  | j
                  | j                  | j                  dd | j                  dd | j                  j                         | j                  d      S | j                  j                               S )aH  Return a copy of the record with a lower case sequence.

        All the annotation is preserved unchanged. e.g.

        >>> from Bio import SeqIO
        >>> record = SeqIO.read("Fasta/aster.pro", "fasta")
        >>> print(record.format("fasta"))
        >gi|3298468|dbj|BAA31520.1| SAMIPF
        GGHVNPAVTFGAFVGGNITLLRGIVYIIAQLLGSTVACLLLKFVTNDMAVGVFSLSAGVG
        VTNALVFEIVMTFGLVYTVYATAIDPKKGSLGTIAPIAIGFIVGANI
        <BLANKLINE>
        >>> print(record.lower().format("fasta"))
        >gi|3298468|dbj|BAA31520.1| SAMIPF
        gghvnpavtfgafvggnitllrgivyiiaqllgstvaclllkfvtndmavgvfslsagvg
        vtnalvfeivmtfglvytvyataidpkkgslgtiapiaigfivgani
        <BLANKLINE>

        To take a more annotation rich example,

        >>> from Bio import SeqIO
        >>> old = SeqIO.read("EMBL/TRBG361.embl", "embl")
        >>> len(old.features)
        3
        >>> new = old.lower()
        >>> len(old.features) == len(new.features)
        True
        >>> old.annotations["organism"] == new.annotations["organism"]
        True
        >>> old.dbxrefs == new.dbxrefs
        True
        NzDseq is SeqRecord is None, assign it a sequence before applying lowerr   )r8   rM   rW   lowerr9   r:   r;   r6   r<   r5   r   r7   r=   rQ   s    r   r   zSeqRecord.loweru  s    @ 88V  ##HHNNww((LLO]]1%((--/ //7  $ 
 	
 ,,113 $ 
 	
r   c                 6    | j                   j                         S )zReturn True if all ASCII characters in the record's sequence are uppercase.

        If there are no cased characters, the method returns False.
        )r8   isupperrQ   s    r   r   zSeqRecord.isupper      
 xx!!r   c                 6    | j                   j                         S )zReturn True if all ASCII characters in the record's sequence are lowercase.

        If there are no cased characters, the method returns False.
        )r8   islowerrQ   s    r   r   zSeqRecord.islower  r   r   c                 J   | j                   t        d      dt        t        | j                  j                  dd            v rt        d      dt        t        | j                  j                  dd            v r| j                   j                         }n| j                   j                         }t        | j                   t              rt        |      }| j                  |      }	t        |t              r||	_        n|r| j                  |	_        t        |t              r||	_        n|r| j                  |	_        t        |t              r||	_        n|r| j                  |	_        t        |t              r||	_        n|r| j                   dd |	_        t        |t              r||	_        nZ|rXt%        |	      }
| j"                  D cg c]  }|j'                  |
       c}|	_        d }|	j"                  j)                  |	       t        |t*              r||	_        n!|r| j                  j-                         |	_        | j.                  Rt        |t*              r	||	_        |	S |r7| j0                  j3                         D ]  \  }}|ddd
   |	j0                  |<    |	S c c}w )a  Return new SeqRecord with reverse complement sequence.

        By default the new record does NOT preserve the sequence identifier,
        name, description, general annotation or database cross-references -
        these are unlikely to apply to the reversed sequence.

        You can specify the returned record's id, name and description as
        strings, or True to keep that of the parent, or False for a default.

        You can specify the returned record's features with a list of
        SeqFeature objects, or True to keep that of the parent, or False to
        omit them. The default is to keep the original features (with the
        strand and locations adjusted).

        You can also specify both the returned record's annotations and
        letter_annotations as dictionaries, True to keep that of the parent,
        or False to omit them. The default is to keep the original
        annotations (with the letter annotations reversed).

        To show what happens to the pre-letter annotations, consider an
        example Solexa variant FASTQ file with a single entry, which we'll
        read in as a SeqRecord:

        >>> from Bio import SeqIO
        >>> record = SeqIO.read("Quality/solexa_faked.fastq", "fastq-solexa")
        >>> print("%s %s" % (record.id, record.seq))
        slxa_0001_1_0001_01 ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTNNNNNN
        >>> print(list(record.letter_annotations))
        ['solexa_quality']
        >>> print(record.letter_annotations["solexa_quality"])
        [40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0, -1, -2, -3, -4, -5]

        Now take the reverse complement, here we explicitly give a new
        identifier (the old identifier with a suffix):

        >>> rc_record = record.reverse_complement(id=record.id + "_rc")
        >>> print("%s %s" % (rc_record.id, rc_record.seq))
        slxa_0001_1_0001_01_rc NNNNNNACGTACGTACGTACGTACGTACGTACGTACGTACGTACGT

        Notice that the per-letter-annotations have also been reversed,
        although this may not be appropriate for all cases.

        >>> print(rc_record.letter_annotations["solexa_quality"])
        [-5, -4, -3, -2, -1, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40]

        Now for the features, we need a different example. Parsing a GenBank
        file is probably the easiest way to get an nice example with features
        in it...

        >>> from Bio import SeqIO
        >>> with open("GenBank/pBAD30.gb") as handle:
        ...     plasmid = SeqIO.read(handle, "gb")
        >>> print("%s %i" % (plasmid.id, len(plasmid)))
        pBAD30 4923
        >>> plasmid.seq
        Seq('GCTAGCGGAGTGTATACTGGCTTACTATGTTGGCACTGATGAGGGTGTCAGTGA...ATG')
        >>> len(plasmid.features)
        13

        Now, let's take the reverse complement of this whole plasmid:

        >>> rc_plasmid = plasmid.reverse_complement(id=plasmid.id+"_rc")
        >>> print("%s %i" % (rc_plasmid.id, len(rc_plasmid)))
        pBAD30_rc 4923
        >>> rc_plasmid.seq
        Seq('CATGGGCAAATATTATACGCAAGGCGACAAGGTGCTGATGCCGCTGGCGATTCA...AGC')
        >>> len(rc_plasmid.features)
        13

        Let's compare the first CDS feature - it has gone from being the
        second feature (index 1) to the second last feature (index -2), its
        strand has changed, and the location switched round.

        >>> print(plasmid.features[1])
        type: CDS
        location: [1081:1960](-)
        qualifiers:
            Key: label, Value: ['araC']
            Key: note, Value: ['araC regulator of the arabinose BAD promoter']
            Key: vntifkey, Value: ['4']
        <BLANKLINE>
        >>> print(rc_plasmid.features[-2])
        type: CDS
        location: [2963:3842](+)
        qualifiers:
            Key: label, Value: ['araC']
            Key: note, Value: ['araC regulator of the arabinose BAD promoter']
            Key: vntifkey, Value: ['4']
        <BLANKLINE>

        You can check this new location, based on the length of the plasmid:

        >>> len(plasmid) - 1081
        3842
        >>> len(plasmid) - 1960
        2963

        Note that if the SeqFeature annotation includes any strand specific
        information (e.g. base changes for a SNP), this information is not
        amended, and would need correction after the reverse complement.

        Note trying to reverse complement a protein SeqRecord raises an
        exception:

        >>> from Bio.Seq import Seq
        >>> from Bio.SeqRecord import SeqRecord
        >>> protein_rec = SeqRecord(Seq("MAIVMGR"), id="Test",
        ...                         annotations={"molecule_type": "protein"})
        >>> protein_rec.reverse_complement()
        Traceback (most recent call last):
           ...
        ValueError: Proteins do not have complements!

        If you have RNA without any U bases, it must be annotated as RNA
        otherwise it will be treated as DNA by default with A mapped to T:

        >>> from Bio.Seq import Seq
        >>> from Bio.SeqRecord import SeqRecord
        >>> rna1 = SeqRecord(Seq("ACG"), id="Test")
        >>> rna2 = SeqRecord(Seq("ACG"), id="Test", annotations={"molecule_type": "RNA"})
        >>> print(rna1.reverse_complement(id="RC", description="unk").format("fasta"))
        >RC unk
        CGT
        <BLANKLINE>
        >>> print(rna2.reverse_complement(id="RC", description="RNA").format("fasta"))
        >RC RNA
        CGU
        <BLANKLINE>

        Also note you can reverse complement a SeqRecord using a MutableSeq:

        >>> from Bio.Seq import MutableSeq
        >>> from Bio.SeqRecord import SeqRecord
        >>> rec = SeqRecord(MutableSeq("ACGT"), id="Test")
        >>> rec.seq[0] = "T"
        >>> print("%s %s" % (rec.id, rec.seq))
        Test TCGT
        >>> rc = rec.reverse_complement(id=True)
        >>> print("%s %s" % (rc.id, rc.seq))
        Test ACGA
        NzfSeq in SeqRecord is None, so can't construct the reverse_complement. Please assign it a sequence firstproteinr^    z!Proteins do not have complements!RNAc                 `    	 t        | j                  j                        S # t        $ r Y yw xY w)zSort on start position.N)r   rf   rk   r&   )rt   s    r   key_funz-SeqRecord.reverse_complement.<locals>.key_fun{  s.     qzz//00    s   ! 	--)r   )r8   rM   r   r1   r5   getreverse_complement_rnareverse_complementr?   r   r   rW   r9   r:   r;   rA   r6   r<   r%   _flipsortr   r   r7   r=   r*   )r   r9   r:   r;   r<   r5   r=   r6   r8   rq   r   rt   r   r   r   s                  r   r   zSeqRecord.reverse_complement  s7   p 88x  S$"2"2"6"6"KLL@AADd..22?BGHH((113C ((--/Cdhh
+c(C%%c*b#FIFIdC FK))FKk3'!,F!%!1!1Fgt$$FN!\\!_FNh%&FO[F8<F1qwwvFFO  OO  W -k4(!,F!%!1!1!6!6!8F''3,d3,>)
 	 $"&"9"9"?"?"A AJC5:4R4[F--c2A9 Gs   J tablestop_symbolto_stopcdsgapc           	         d| j                   j                  dd      k(  rt        d      | j                  t        d      t	        | j                  j                  |||||            }t        |t              r||_        n|r| j                  |_        t        |t              r||_	        n|r| j                  |_	        t        |t              r||_
        n|r| j                  |_
        t        |t              r||_        n|r| j                  dd |_        t        |	t              r|	|_        n|	rt        d|	      t        |
t              r|
|_         n!|
r| j                   j!                         |_         d|j                   d<   | j"                  )t        |t              r	||_        |S |rt        d	|      |S )
a8  Return new SeqRecord with translated sequence.

        This calls the record's .seq.translate() method (which describes
        the translation related arguments, like table for the genetic code),

        By default the new record does NOT preserve the sequence identifier,
        name, description, general annotation or database cross-references -
        these are unlikely to apply to the translated sequence.

        You can specify the returned record's id, name and description as
        strings, or True to keep that of the parent, or False for a default.

        You can specify the returned record's features with a list of
        SeqFeature objects, or False (default) to omit them.

        You can also specify both the returned record's annotations and
        letter_annotations as dictionaries, True to keep that of the parent
        (annotations only), or False (default) to omit them.

        e.g. Loading a FASTA gene and translating it,

        >>> from Bio import SeqIO
        >>> gene_record = SeqIO.read("Fasta/sweetpea.nu", "fasta")
        >>> print(gene_record.format("fasta"))
        >gi|3176602|gb|U78617.1|LOU78617 Lathyrus odoratus phytochrome A (PHYA) gene, partial cds
        CAGGCTGCGCGGTTTCTATTTATGAAGAACAAGGTCCGTATGATAGTTGATTGTCATGCA
        AAACATGTGAAGGTTCTTCAAGACGAAAAACTCCCATTTGATTTGACTCTGTGCGGTTCG
        ACCTTAAGAGCTCCACATAGTTGCCATTTGCAGTACATGGCTAACATGGATTCAATTGCT
        TCATTGGTTATGGCAGTGGTCGTCAATGACAGCGATGAAGATGGAGATAGCCGTGACGCA
        GTTCTACCACAAAAGAAAAAGAGACTTTGGGGTTTGGTAGTTTGTCATAACACTACTCCG
        AGGTTTGTT
        <BLANKLINE>

        And now translating the record, specifying the new ID and description:

        >>> protein_record = gene_record.translate(table=11,
        ...                                        id="phya",
        ...                                        description="translation")
        >>> print(protein_record.format("fasta"))
        >phya translation
        QAARFLFMKNKVRMIVDCHAKHVKVLQDEKLPFDLTLCGSTLRAPHSCHLQYMANMDSIA
        SLVMAVVVNDSDEDGDSRDAVLPQKKKRLWGLVVCHNTTPRFV
        <BLANKLINE>

        r   r^   r   zProteins cannot be translated!Nz-Seq in SeqRecord is None, can't be translated)r   r   r   r   r   zUnexpected features argument z'Unexpected letter_annotations argument )r5   r   rM   r8   r4   	translater?   r1   r9   r:   r;   rA   r6   r<   r&   r   r   r7   r=   )r   r   r   r   r   r   r9   r:   r;   r<   r5   r=   r6   rq   s                 r   r   zSeqRecord.translate  s   | ((,,_bAA=>>88LMMHHg3TW  

 b#FIFIdC FK))FKk3'!,F!%!1!1Fgt$$FN!\\!_FNh%&FO;H<HIIk4(!,F!%!1!1!6!6!8F.7?+''3,d3,>)  $=>P=ST  r   )z<unknown id>z<unknown name>z<unknown description>NNNN)NN)r   r4   )FFFTFTF)Standard*FFNFFFFFFF)8r-   r.   r/   r0   r1   r   _AnnotationsDictValuer   _AnnotationsDict__annotations__rA   r   r   r	   r   r   propertyr=   setterr8   classmethodr   r   rW   r   r"   rb   r   rw   boolr{   r}   r~   r   r   r   r   r!   r   r   r   objectr   r   r   r   r   r   r   r   r   r   r   r   r   r   r2   r   r   r4   r4   r   s>   8t  #IC!667!!#Y,t33
 ($2$(.2/3>BO!&'$.O! $JO! 	O!
 O! cT!O! |$t+O! &,O! !hsm!34t;O! 
O!b 5,Dhsm);$< 5, 5,p 9S(3--?(@ 9T 9 9" U./$6   	ZZJ23 J J J$  ($2$(.2379=/:$/ $J/ 	/
 / cT!/ |$t+/ #sSy.)D0/ !h/$6/ 
/ /b 111 1;;;; ;z*x6(3- 6p! ! !> 5  
:  : x
# 
B'S 'S '@$c $c $L> ><C <H <<C <H <<F <x <<F <x <<C <H <<C <H <$ B;|S@AB	BH&
eE<$<= &
+ &
P
/+
Z1
f"" !!#'YY Y 	Y
 Y Y !Y Y 
Y|  !!#(n n 	n
 n n 4Zn n n n n n !n n  
!nr   r4   __main__)run_doctest)r0   r`   typingr   r   collections.abcr   r   r   r   r	   r
   r   r   r   Bio.Seqr   r   r   Bio.SeqFeaturer   r   r   r1   r   r4   r-   
Bio._utilsr   r2   r   r   <module>r      s    ?
    $    $       *) B Jd3-. JZM M`, z&M r   